PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011094923.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 623aa    MW: 68537.9 Da    PI: 7.3823
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011094923.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-094214581954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  XP_011094923.1 421 FEHflHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVR 458
                     554459******************************88 PP

2BELL99.33e-32290358472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e  +kk++Lls+l+eV+krYkqy++q+q+ +++Fe vagl  a+p+++lAlka+S+hFr+Lk+ai++q+
  XP_011094923.1 290 EQTRKKSRLLSMLHEVYKRYKQYYQQMQAAVAAFESVAGLSGAAPFANLALKAMSKHFRSLKNAITDQL 358
                     7789**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-45223356IPR006563POX domain
PfamPF075261.0E-34228355IPR006563POX domain
PROSITE profilePS5007112.098399462IPR001356Homeobox domain
SMARTSM003897.3E-10402466IPR001356Homeobox domain
CDDcd000868.16E-13402463No hitNo description
SuperFamilySSF466895.99E-17404470IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-27405466IPR009057Homeodomain-like
PfamPF059201.6E-18419458IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MAEGLESYHV PQQSRRDKLR VNNHSPACLD NLQSCCAPLL SAHDPPLISS DFNLHRQSFS  60
LAPNTNAGVK EEGMNLMGFV GGNHHMYVDP QLGPLQLNPT SIQDISGSPC VYAAPSPHCY  120
RGLLLDQSFH GNEVVVYKPD QTLSIPHQHP NPNSSTAATN AQSLSLSLSS HHSNNLPLEL  180
NLQRYESSMF SNNKVSGGLL VSCNGGSTSI QLSKSSVPLG PFTGYASVLK GSRFLKPAQQ  240
LLEELCDVGR GIGIYAEKIG ADSFLLDPPP MESLSGIVDD PLNFSTDGGE QTRKKSRLLS  300
MLHEVYKRYK QYYQQMQAAV AAFESVAGLS GAAPFANLAL KAMSKHFRSL KNAITDQLQF  360
TTKSHGKINC ERDETHGLES SGKSTYGERT FQSTGFIDQP VWRPQRGLPE RAVTVLRAWL  420
FEHFLHPYPT DTDKLMLAKQ TGLSRNQVSN WFINARVRLW KPMVEEIHML ETRQSQKPSQ  480
REEQPPNRLN DHLPTSCSIE CENASTSVQR IGEIPSKRNR EDPTGTATRG NEGPMRFSYD  540
NLLHNPWLGV GVSHTGGNGG VSLTLGLHQN GMGLSDPYPI NAARRFGLES QGDGYVASGF  600
AAQNRQFGRD INMDGQLMHD FVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A4e-16408466563Homeobox protein Meis2
4xrm_B4e-16408466563Homeobox protein Meis2
4xrs_A4e-16408465158Homeobox protein Meis1
4xrs_B4e-16408465158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094923.10.0PREDICTED: BEL1-like homeodomain protein 9 isoform X1
TrEMBLA5AHA10.0A5AHA1_VITVI; Putative uncharacterized protein
TrEMBLF6HL250.0F6HL25_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-91TALE family protein